PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G066500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 24118.7 Da    PI: 8.2635
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G066500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.61.9e-29959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien  nrqvtfskRr+gilKKA+E+SvLCdaev v+ifss gklye++s
  Brast01G066500.1.p  9 KRIENPANRQVTFSKRRHGILKKAKEISVLCDAEVGVVIFSSAGKLYEFCS 59
                        79***********************************************96 PP

2K-box75.41.6e-2571166196
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         yq +sgk l+++k++sl+ e++++kke++++q e+Rhl+GedL+sL+ keL  +e++L+++l+++ +k++e++ + +++ ++ e+e++   
  Brast01G066500.1.p  71 YQINSGKILWDEKHKSLSAEIDRIKKENDSMQIELRHLKGEDLNSLQPKELIMIEEALDNGLTNVHEKQMEHWDRLMKNGKMLEDENKLLA 161
                         56678888********************************************************************************999 PP

               K-box  92 kaLrk 96 
                          +L++
  Brast01G066500.1.p 162 FKLHQ 166
                         99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.31161IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-33296IPR002100Transcription factor, MADS-box
CDDcd002651.19E-40280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-30323IPR002100Transcription factor, MADS-box
PfamPF003195.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-303859IPR002100Transcription factor, MADS-box
PfamPF014863.0E-1782164IPR002487Transcription factor, K-box
PROSITE profilePS5129713.19684170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MGRGKIEIKR IENPANRQVT FSKRRHGILK KAKEISVLCD AEVGVVIFSS AGKLYEFCSS  60
KTSLSRILEK YQINSGKILW DEKHKSLSAE IDRIKKENDS MQIELRHLKG EDLNSLQPKE  120
LIMIEEALDN GLTNVHEKQM EHWDRLMKNG KMLEDENKLL AFKLHQHDIA LSGSMRDLEL  180
GYHAERDFAA QMPITFRVQP SHPNLQENN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20171169Myocyte-specific enhancer factor 2B
1tqe_Q2e-20171169Myocyte-specific enhancer factor 2B
1tqe_R2e-20171169Myocyte-specific enhancer factor 2B
1tqe_S2e-20171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693150.0KF469315.1 Brachypodium distachyon MADS-box transcription factor 20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288308.11e-151MADS-box transcription factor 2-like
SwissprotQ407021e-138MADS2_ORYSJ; MADS-box transcription factor 2
TrEMBLI1HU091e-151I1HU09_BRADI; MADS-box transcription factor 20
STRINGBRADI2G57000.11e-150(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.16e-72MIKC_MADS family protein